UCK2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10815T
Artikelname: UCK2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10815T
Hersteller Artikelnummer: CNA10815T
Alternativnummer: MBL-CNA10815T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-261 of human UCK2 (NP_036606.2).
Konjugation: Unconjugated
Alternative Synonym: UK, UMPK, TSA903
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 7371
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQAS
Target-Kategorie: UCK2
Application Verdünnung: WB: WB,1:500 - 1:2000