MYT1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA10824T
| Artikelname: |
MYT1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA10824T |
| Hersteller Artikelnummer: |
CNA10824T |
| Alternativnummer: |
MBL-CNA10824T |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 650-820 of human MYT1 (NP_004526.1). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
MTF1, MYTI, NZF2, PLPB1, ZC2H2C1, ZC2HC4A, C20orf36 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
122kDa |
| NCBI: |
4661 |
| Puffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequenz: |
KPQDLPSKSVDIEVDENGTLDLSMHKHRKRENAFPSSSSCSSSPGVKSPDASQRHSSTSAPSSSMTSPQSSQASRQDEWDRPLDYTKPSRLREEEPEESEPAAHSFASSEADDQEVSEENFEERKYPGEVTLTNFKLKFLSKDIKKELLTCPTPGCDGSGHITGNYASHRS |
| Target-Kategorie: |
MYT1 |
| Application Verdünnung: |
WB: WB,1:500 - 1:2000 |
