Lysozyme (LYZ) Rabbit mAb, Clone: [ARC57153], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA10972P
Artikelname: Lysozyme (LYZ) Rabbit mAb, Clone: [ARC57153], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA10972P
Hersteller Artikelnummer: CNA10972P
Alternativnummer: MBL-CNA10972P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (LYZ) (NP_000230.1).
Konjugation: Unconjugated
Alternative Synonym: LZM,LYZF1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC57153]
Molekulargewicht: 17kDa
NCBI: 4069
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS
Target-Kategorie: LYZ
Application Verdünnung: WB: WB,1:3000 - 1:20000|IHC-P,1:50 - 1:200