Alpha-Fetoprotein (AFP) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11013T
Artikelname: Alpha-Fetoprotein (AFP) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11013T
Hersteller Artikelnummer: CNA11013T
Alternativnummer: MBL-CNA11013T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 395-609 of Alpha-Fetoprotein (AFP) (NP_001125.1).
Konjugation: Unconjugated
Alternative Synonym: AFPD, FETA, HPAFP
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 174
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Target-Kategorie: AFP
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200