APP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11019P
Artikelname: APP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11019P
Hersteller Artikelnummer: CNA11019P
Alternativnummer: MBL-CNA11019P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human APP (NP_000475.1).
Konjugation: Unconjugated
Alternative Synonym: AAA, AD1, PN2, ABPP, APPI, CVAP, ABETA, PN-II, preA4, CTFgamma, alpha-sAPP
Klonalität: Polyclonal
Molekulargewicht: 87kDa
NCBI: 351
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKR
Target-Kategorie: APP
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200