Tau Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1103S
Artikelname: Tau Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1103S
Hersteller Artikelnummer: CNA1103S
Alternativnummer: MBL-CNA1103S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human Tau (NP_058519.3).
Konjugation: Unconjugated
Alternative Synonym: TAU, MSTD, PPND, DDPAC, MAPTL, MTBT1, MTBT2, tau-40, FTDP-17, PPP1R103, Tau-PHF6
Klonalität: Polyclonal
Molekulargewicht: 79kDa
NCBI: 4137
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: DLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Target-Kategorie: MAPT
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200