AP2M1 Rabbit mAb, Clone: [ARC0522], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11070S
Artikelname: AP2M1 Rabbit mAb, Clone: [ARC0522], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11070S
Hersteller Artikelnummer: CNA11070S
Alternativnummer: MBL-CNA11070S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human AP2M1 (Q96CW1).
Konjugation: Unconjugated
Alternative Synonym: mu2, AP50, MRD60, CLAPM1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0522]
Molekulargewicht: 50kDa
NCBI: 1173
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: KLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLK
Target-Kategorie: AP2M1
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200