EpCAM Rabbit mAb, Clone: [ARC0521], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA1107S
Artikelname: EpCAM Rabbit mAb, Clone: [ARC0521], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA1107S
Hersteller Artikelnummer: CNA1107S
Alternativnummer: MBL-CNA1107S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EpCAM (P16422).
Konjugation: Unconjugated
Alternative Synonym: ESA, KSA, M4S1, MK-1, DIAR5, EGP-2, EGP40, KS1/4, MIC18, TROP1, BerEp4, EGP314, HNPCC8, LYNCH8, MOC-31, Ber-Ep4, TACSTD1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0521]
Molekulargewicht: 35kDa
NCBI: 4072
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCD
Target-Kategorie: EPCAM
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200