IRF5 Rabbit mAb, Clone: [ARC0525], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA11106S
| Artikelname: |
IRF5 Rabbit mAb, Clone: [ARC0525], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA11106S |
| Hersteller Artikelnummer: |
CNA11106S |
| Alternativnummer: |
MBL-CNA11106S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IP, WB |
| Spezies Reaktivität: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 6-151 of human IRF5 (Q13568). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
SLEB10 |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC0525] |
| Molekulargewicht: |
56kDa |
| NCBI: |
3663 |
| Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequenz: |
PVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQ |
| Target-Kategorie: |
IRF5 |
| Application Verdünnung: |
WB: WB,1:500 - 1:2000|IP,1:100 - 1:500 |
