IGFBP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11109P
Artikelname: IGFBP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11109P
Hersteller Artikelnummer: CNA11109P
Alternativnummer: MBL-CNA11109P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 81-259 of human IGFBP1 (NP_000587.1).
Konjugation: Unconjugated
Alternative Synonym: AFBP, IBP1, PP12, IGF-BP25, hIGFBP-1
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 3484
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: GLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Target-Kategorie: IGFBP1
Application Verdünnung: WB: WB,1:500 - 1:1000