[KO Validated] CDK4 Rabbit mAb, Clone: [ARC51004], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11136P
Artikelname: [KO Validated] CDK4 Rabbit mAb, Clone: [ARC51004], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11136P
Hersteller Artikelnummer: CNA11136P
Alternativnummer: MBL-CNA11136P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Monkey, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1).
Konjugation: Unconjugated
Alternative Synonym: CMM3, PSK-J3
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51004]
Molekulargewicht: 34kDa
NCBI: 1019
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: FAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Target-Kategorie: CDK4
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:100 - 1:500