[KO Validated] CDK9 Rabbit mAb, Clone: [ARC0527], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11145S
Artikelname: [KO Validated] CDK9 Rabbit mAb, Clone: [ARC0527], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11145S
Hersteller Artikelnummer: CNA11145S
Alternativnummer: MBL-CNA11145S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 273-372 of human CDK9 (P50750).
Konjugation: Unconjugated
Alternative Synonym: TAK, C-2k, CTK1, CDC2L4, PITALRE
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0527]
Molekulargewicht: 43kDa
NCBI: 1025
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
Target-Kategorie: CDK9
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000|ChIP,1:50 - 1:200|ChIP-seq,2-4µg/IP|CUT&Tag, 105 cells /5 µg