MMP13 Rabbit mAb, Clone: [ARC0528], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11148S
Artikelname: MMP13 Rabbit mAb, Clone: [ARC0528], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11148S
Hersteller Artikelnummer: CNA11148S
Alternativnummer: MBL-CNA11148S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human MMP13 (P45452).
Konjugation: Unconjugated
Alternative Synonym: CLG3, MDST, MANDP1, MMP-13
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0528]
Molekulargewicht: 54kDa
NCBI: 4322
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQF
Target-Kategorie: MMP13
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200