MGMT Rabbit mAb, Clone: [ARC0529], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11151P
Artikelname: MGMT Rabbit mAb, Clone: [ARC0529], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11151P
Hersteller Artikelnummer: CNA11151P
Alternativnummer: MBL-CNA11151P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MGMT (P16455).
Konjugation: Unconjugated
Alternative Synonym: MGMT, O-6-methylguanine-DNA methyltransferase
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0529]
Molekulargewicht: 22kDa
NCBI: 4255
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: FGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
Target-Kategorie: MGMT
Application Verdünnung: WB: WB,1:500 - 1:1000