MRP1/ABCC1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11153S
Artikelname: MRP1/ABCC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11153S
Hersteller Artikelnummer: CNA11153S
Alternativnummer: MBL-CNA11153S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 850-960 of human MRP1/ABCC1 (NP_004987.2).
Konjugation: Unconjugated
Alternative Synonym: MRP, ABCC, GS-X, MRP1, ABC29, DFNA77
Klonalität: Polyclonal
Molekulargewicht: 172kDa
NCBI: 4363
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKL
Target-Kategorie: ABCC1
Application Verdünnung: WB: WB,1:500 - 1:2000