ROCK1 Rabbit mAb, Clone: [ARC2371], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11158S
Artikelname: ROCK1 Rabbit mAb, Clone: [ARC2371], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11158S
Hersteller Artikelnummer: CNA11158S
Alternativnummer: MBL-CNA11158S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human ROCK1 (Q13464).
Konjugation: Unconjugated
Alternative Synonym: ROCK-I, P160ROCK
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2371]
Molekulargewicht: 158kDa
Sensitivitaet: 0.8 mg/mL
NCBI: 6093
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: STSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
Target-Kategorie: ROCK1
Application Verdünnung: WB: WB,1:500 - 1:1000