NFKB1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11160T
Artikelname: NFKB1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11160T
Hersteller Artikelnummer: CNA11160T
Alternativnummer: MBL-CNA11160T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 41-365 of NFKB1 (NP_001158884.1).
Konjugation: Unconjugated
Alternative Synonym: KBF1, EBP-1, NF-kB, CVID12, NF-kB1, NFKB-p50, NFkappaB, NF-kappaB, NFKB-p105, NF-kappa-B1, NF-kappabeta
Klonalität: Polyclonal
Molekulargewicht: 105kDa
NCBI: 4790
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVW
Target-Kategorie: NFKB1
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:20 - 1:100|IP,1:20 - 1:50