Myelin Basic Protein Rabbit mAb, Clone: [ARC0535], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11162S
Artikelname: Myelin Basic Protein Rabbit mAb, Clone: [ARC0535], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11162S
Hersteller Artikelnummer: CNA11162S
Alternativnummer: MBL-CNA11162S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 161-304 of human Myelin Basic Protein (P02686).
Konjugation: Unconjugated
Alternative Synonym: MBP, myelin basic protein
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0535]
Molekulargewicht: 33kDa
NCBI: 4155
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR
Target-Kategorie: MBP
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200