PPARgamma Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11183T
Artikelname: PPARgamma Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11183T
Hersteller Artikelnummer: CNA11183T
Alternativnummer: MBL-CNA11183T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PPARgamma (NP_056953.2).
Konjugation: Unconjugated
Alternative Synonym: GLM1, CIMT1, NR1C3, PPARG1, PPARG2, PPARG5, PPARgamma
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 5468
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
Target-Kategorie: PPARG
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:100 - 1:500