Insulin-degrading enzyme (IDE) Rabbit mAb, Clone: [ARC0537], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11190S
Artikelname: Insulin-degrading enzyme (IDE) Rabbit mAb, Clone: [ARC0537], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11190S
Hersteller Artikelnummer: CNA11190S
Alternativnummer: MBL-CNA11190S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Insulin-degrading enzyme (IDE) (P14735).
Konjugation: Unconjugated
Alternative Synonym: INSULYSIN
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0537]
Molekulargewicht: 118kDa
NCBI: 3416
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MRYRLAWLLHPALPSTFRSVLGARLPPPERLCGFQKKTYSKMNNPAIKRIGNHITKSPEDKREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDP
Target-Kategorie: IDE
Application Verdünnung: WB: WB,1:500 - 1:1000