FAK Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11195P
Artikelname: FAK Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11195P
Hersteller Artikelnummer: CNA11195P
Alternativnummer: MBL-CNA11195P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 734-834 of human FAK (NP_722560.1).
Konjugation: Unconjugated
Alternative Synonym: FAK, FADK, FAK1, FRNK, FADK 1, PPP1R71, p125FAK, pp125FAK
Klonalität: Polyclonal
Molekulargewicht: 119kDa
NCBI: 5747
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: QHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLK
Target-Kategorie: PTK2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100