Complement C3 Rabbit mAb, Clone: [ARC0541], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA11196S
| Artikelname: |
Complement C3 Rabbit mAb, Clone: [ARC0541], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA11196S |
| Hersteller Artikelnummer: |
CNA11196S |
| Alternativnummer: |
MBL-CNA11196S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Complement Complement C3 (P01024). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
ASP, C3a, C3b, AHUS5, ARMD9, CPAMD1, HEL-S-62p |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC0541] |
| Molekulargewicht: |
187kDa |
| NCBI: |
718 |
| Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequenz: |
GRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQL |
| Target-Kategorie: |
C3 |
| Application Verdünnung: |
WB: WB,1:500 - 1:1000 |
