Galectin 3/LGALS3 Rabbit mAb, Clone: [ARC0542], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11198S
Artikelname: Galectin 3/LGALS3 Rabbit mAb, Clone: [ARC0542], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11198S
Hersteller Artikelnummer: CNA11198S
Alternativnummer: MBL-CNA11198S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Galectin 3/LGALS3 (P17931).
Konjugation: Unconjugated
Alternative Synonym: L31, GAL3, MAC2, CBP35, GALBP, GALIG, LGALS2
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0542]
Molekulargewicht: 26kDa
NCBI: 3958
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGA
Target-Kategorie: LGALS3
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:100 - 1:500