NF-kB p65/RelA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11202T
Artikelname: NF-kB p65/RelA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11202T
Hersteller Artikelnummer: CNA11202T
Alternativnummer: MBL-CNA11202T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-551 of human NF-kB p65/RelA (NP_068810.3).
Konjugation: Unconjugated
Alternative Synonym: p65, CMCU, NFKB3, AIF3BL3
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 5970
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
Target-Kategorie: RELA
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200