GLUT1/SLC2A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11208T
Artikelname: GLUT1/SLC2A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11208T
Hersteller Artikelnummer: CNA11208T
Alternativnummer: MBL-CNA11208T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human GLUT1/SLC2A1 (NP_006507.2).
Konjugation: Unconjugated
Alternative Synonym: CSE, PED, DYT9, GLUT, DYT17, DYT18, EIG12, GLUT1, HTLVR, GLUT-1, SDCHCN, GLUT1DS
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 6513
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV
Target-Kategorie: SLC2A1
Application Verdünnung: WB: WB,1:500 - 1:2000