FABP1 Rabbit mAb, Clone: [ARC0545], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11213S
Artikelname: FABP1 Rabbit mAb, Clone: [ARC0545], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11213S
Hersteller Artikelnummer: CNA11213S
Alternativnummer: MBL-CNA11213S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABP1 (P07148).
Konjugation: Unconjugated
Alternative Synonym: FABPL, L-FABP
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0545]
Molekulargewicht: 14kDa
NCBI: 2168
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKS
Target-Kategorie: FABP1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200