ATPB Rabbit mAb, Clone: [ARC53533], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11214P
Artikelname: ATPB Rabbit mAb, Clone: [ARC53533], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11214P
Hersteller Artikelnummer: CNA11214P
Alternativnummer: MBL-CNA11214P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 230-529 of human ATPB (NP_001677.2).
Konjugation: Unconjugated
Alternative Synonym: ATP5B, ATPMB, ATPSB, HUMOP2, HEL-S-271
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC53533]
Molekulargewicht: 57kDa
NCBI: 506
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVP
Target-Kategorie: ATP5F1B
Application Verdünnung: WB: WB,1:3000 - 1:20000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200