Catalase Rabbit mAb, Clone: [ARC0550], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11220S
Artikelname: Catalase Rabbit mAb, Clone: [ARC0550], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11220S
Hersteller Artikelnummer: CNA11220S
Alternativnummer: MBL-CNA11220S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Catalase (P04040).
Konjugation: Unconjugated
Alternative Synonym: CAT, catalase
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0550]
Molekulargewicht: 60kDa
Sensitivitaet: 0.33 mg/mL
NCBI: 847
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVF
Target-Kategorie: CAT
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200