Ku70 Rabbit mAb, Clone: [ARC0551], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11223S
Artikelname: Ku70 Rabbit mAb, Clone: [ARC0551], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11223S
Hersteller Artikelnummer: CNA11223S
Alternativnummer: MBL-CNA11223S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-609 of human Ku70 (P12956).
Konjugation: Unconjugated
Alternative Synonym: ML8, KU70, TLAA, CTC75, CTCBF, G22P1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0551]
Molekulargewicht: 70kDa
NCBI: 2547
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD
Target-Kategorie: XRCC6
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200