TLR2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11225S
Artikelname: TLR2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11225S
Hersteller Artikelnummer: CNA11225S
Alternativnummer: MBL-CNA11225S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human TLR2 (NP_003255.2).
Konjugation: Unconjugated
Alternative Synonym: TIL4, CD282
Klonalität: Polyclonal
Molekulargewicht: 90kDa
NCBI: 7097
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTV
Target-Kategorie: TLR2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200