CRH Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1122S
Artikelname: CRH Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1122S
Hersteller Artikelnummer: CNA1122S
Alternativnummer: MBL-CNA1122S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-194 of human CRH (NP_000747.1).
Konjugation: Unconjugated
Alternative Synonym: CRF, CRH1
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 1392
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
Target-Kategorie: CRH
Application Verdünnung: WB: WB,1:500 - 1:2000