MIF Rabbit mAb, Clone: [ARC0552], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11231P
Artikelname: MIF Rabbit mAb, Clone: [ARC0552], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11231P
Hersteller Artikelnummer: CNA11231P
Alternativnummer: MBL-CNA11231P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human MIF (NP_002406.1).
Konjugation: Unconjugated
Alternative Synonym: GIF, GLIF, MMIF
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0552]
Molekulargewicht: 12kDa
NCBI: 4282
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Target-Kategorie: MIF
Application Verdünnung: WB: WB,1:500 - 1:1000