G6PD Rabbit mAb, Clone: [ARC0553], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11234S
Artikelname: G6PD Rabbit mAb, Clone: [ARC0553], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11234S
Hersteller Artikelnummer: CNA11234S
Alternativnummer: MBL-CNA11234S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human G6PD (P11413).
Konjugation: Unconjugated
Alternative Synonym: G6PD1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0553]
Molekulargewicht: 59kDa
NCBI: 2539
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: VYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVG
Target-Kategorie: G6PD
Application Verdünnung: WB: WB,1:500 - 1:2000