SERPINC1 Rabbit mAb, Clone: [ARC0559], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11249S
Artikelname: SERPINC1 Rabbit mAb, Clone: [ARC0559], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11249S
Hersteller Artikelnummer: CNA11249S
Alternativnummer: MBL-CNA11249S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SERPINC1 (P01008).
Konjugation: Unconjugated
Alternative Synonym: AT3, AT3D, ATIII, THPH7, ATIII-R2, ATIII-T1, ATIII-T2
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0559]
Molekulargewicht: 58kDa
NCBI: 462
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWELSKANSRFATTFYQHLAD
Target-Kategorie: SERPINC1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200