Grp75/MOT/HSPA9 Rabbit mAb, Clone: [ARC0566], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11256S
Artikelname: Grp75/MOT/HSPA9 Rabbit mAb, Clone: [ARC0566], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11256S
Hersteller Artikelnummer: CNA11256S
Alternativnummer: MBL-CNA11256S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 580-679 of human Grp75/MOT/HSPA9 (P38646).
Konjugation: Unconjugated
Alternative Synonym: CSA, MOT, MOT2, SAAN, CRP40, EVPLS, GRP75, PBP74, GRP-75, HSPA9B, SIDBA4, MTHSP75, HEL-S-124m
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0566]
Molekulargewicht: 74kDa
NCBI: 3313
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: EAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ
Target-Kategorie: HSPA9
Application Verdünnung: WB: WB,1:500 - 1:1000