HDAC6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11259S
Artikelname: HDAC6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11259S
Hersteller Artikelnummer: CNA11259S
Alternativnummer: MBL-CNA11259S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 836-1104 of human HDAC6 (NP_006035.2).
Konjugation: Unconjugated
Alternative Synonym: HD6, JM21, CPBHM, PPP1R90
Klonalität: Polyclonal
Molekulargewicht: 131kDa
NCBI: 10013
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: VMKVEDREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSETAVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGAILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQTPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEAAGGQDMADS
Target-Kategorie: HDAC6
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:100 - 1:500|IF/ICC,1:50 - 1:200|IP,1:20 - 1:50