YAP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11265S
Artikelname: YAP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11265S
Hersteller Artikelnummer: CNA11265S
Alternativnummer: MBL-CNA11265S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1).
Konjugation: Unconjugated
Alternative Synonym: YAP, YKI, COB1, YAP2, YAP-1, YAP65
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 10413
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYS
Target-Kategorie: YAP1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200