Cardiac troponin T (TNNT2) Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Cardiac troponin T (TNNT2) Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: MBL-CNA1126S
• Hersteller Artikelnummer: CNA1126S
• Alternativnummer: MBL-CNA1126S
• Hersteller: MBL
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ICC, IF, IHC-P, WB
• Spezies Reaktivität: Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Cardiac troponin T (Cardiac troponin T (TNNT2)) (NP_001001431.1).
• Konjugation: Unconjugated
• Alternative Synonym: CMH2, RCM3, TnTC, cTnT, CMD1D, CMPD2, LVNC6

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 36kDa
• NCBI: 7139
• Puffer: PBS with 0.02% sodium azide,50% glycerol
• Quelle: Rabbit
• Reinheit: Affinity purification
• Formulierung: PBS with 0.02% sodium azide,50% glycerol
• Sequenz: MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEEL
• Target-Kategorie: TNNT2

Anwendungsbeschreibung

• Application Verdünnung: WB: WB,1:1000 - 1:5000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200