IDH2 Rabbit mAb, Clone: [ARC0567], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11270S
Artikelname: IDH2 Rabbit mAb, Clone: [ARC0567], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11270S
Hersteller Artikelnummer: CNA11270S
Alternativnummer: MBL-CNA11270S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 353-452 of human IDH2 (P48735).
Konjugation: Unconjugated
Alternative Synonym: IDH, IDP, IDHM, IDPM, ICD-M, IDH-2, D2HGA2, mNADP-IDH
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0567]
Molekulargewicht: 51kDa
NCBI: 3418
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ
Target-Kategorie: IDH2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200