[KO Validated] NADPH oxidase 4 (NOX4) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11274P
Artikelname: [KO Validated] NADPH oxidase 4 (NOX4) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11274P
Hersteller Artikelnummer: CNA11274P
Alternativnummer: MBL-CNA11274P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 479-578 of human NADPH oxidase 4 (NOX4) (NP_058627.2).
Konjugation: Unconjugated
Alternative Synonym: KOX, KOX-1, RENOX
Klonalität: Polyclonal
Molekulargewicht: 67kDa
NCBI: 50507
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS
Target-Kategorie: NOX4
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200