PHPT1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1127S
Artikelname: PHPT1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1127S
Hersteller Artikelnummer: CNA1127S
Alternativnummer: MBL-CNA1127S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human PHPT1 (NP_054891.2).
Konjugation: Unconjugated
Alternative Synonym: PHP, PHP14, CGI-202, HSPC141, HEL-S-132P
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 29085
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Target-Kategorie: PHPT1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200