ANGPT2 Rabbit mAb, Clone: [ARC0571], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11306S
Artikelname: ANGPT2 Rabbit mAb, Clone: [ARC0571], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11306S
Hersteller Artikelnummer: CNA11306S
Alternativnummer: MBL-CNA11306S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ANGPT2 (O15123).
Konjugation: Unconjugated
Alternative Synonym: ANG2, AGPT2, LMPHM10
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0571]
Molekulargewicht: 57kDa
NCBI: 285
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: LTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYR
Target-Kategorie: ANGPT2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200