AMACR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1130T
Artikelname: AMACR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1130T
Hersteller Artikelnummer: CNA1130T
Alternativnummer: MBL-CNA1130T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-138 of human AMACR (NP_055139.4).
Konjugation: Unconjugated
Alternative Synonym: RM, RACE, CBAS4, P504S, AMACRD
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 23600
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGVLSKIGR
Target-Kategorie: AMACR
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200