BMP4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11315P
Artikelname: BMP4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11315P
Hersteller Artikelnummer: CNA11315P
Alternativnummer: MBL-CNA11315P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human BMP4 (NP_001193.2).
Konjugation: Unconjugated
Alternative Synonym: ZYME, BMP2B, OFC11, BMP2B1, MCOPS6
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 652
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: QHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLN
Target-Kategorie: BMP4
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200