Caspase-3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11319P
Artikelname: Caspase-3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11319P
Hersteller Artikelnummer: CNA11319P
Alternativnummer: MBL-CNA11319P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 40-100 of human Caspase-3 (NP_116786.1).
Konjugation: Unconjugated
Alternative Synonym: CPP32, SCA-1, CPP32B
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 836
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: DYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELM
Target-Kategorie: CASP3
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:100 - 1:500