Caspase-8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11324S
Artikelname: Caspase-8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11324S
Hersteller Artikelnummer: CNA11324S
Alternativnummer: MBL-CNA11324S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 4-480 of mouse Caspase 8 (O89110).
Konjugation: Unconjugated
Alternative Synonym: MACH, Mch5, FLICE, CASP-8
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 12370
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: FEQQNHTLEVDSSSHKNYIPDEADFLLGMATVKNCVSYRDPVNGTWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDRRNKGKQMPQPTFTLRKKLFFPP
Target-Kategorie: Casp8
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200