CTCF Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1133P
Artikelname: CTCF Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1133P
Hersteller Artikelnummer: CNA1133P
Alternativnummer: MBL-CNA1133P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human CTCF (NP_006556.1).
Konjugation: Unconjugated
Alternative Synonym: MRD21, FAP108, CFAP108
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 10664
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEVNAEKVVGNMKPPKP
Target-Kategorie: CTCF
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500|ChIP,1:50 - 1:200