p38 MAPK Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA11340T
Artikelname: |
p38 MAPK Rabbit pAb, Unconjugated, Polyclonal |
Artikelnummer: |
MBL-CNA11340T |
Hersteller Artikelnummer: |
CNA11340T |
Alternativnummer: |
MBL-CNA11340T |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human p38 MAPK (NP_620581.1). |
Konjugation: |
Unconjugated |
Alternative Synonym: |
RK, p38, CSBP, EXIP, Mxi2, CSBP1, CSBP2, CSPB1, PRKM14, PRKM15, SAPK2A, p38ALPHA |
Klonalität: |
Polyclonal |
Molekulargewicht: |
41kDa |
NCBI: |
1432 |
Puffer: |
PBS with 0.01% thimerosal,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.01% thimerosal,50% glycerol |
Sequenz: |
AQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
Target-Kategorie: |
MAPK14 |
Application Verdünnung: |
WB: WB,1:500 - 1:1000 |