p38 MAPK Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11340T
Artikelname: p38 MAPK Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11340T
Hersteller Artikelnummer: CNA11340T
Alternativnummer: MBL-CNA11340T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human p38 MAPK (NP_620581.1).
Konjugation: Unconjugated
Alternative Synonym: RK, p38, CSBP, EXIP, Mxi2, CSBP1, CSBP2, CSPB1, PRKM14, PRKM15, SAPK2A, p38ALPHA
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 1432
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Target-Kategorie: MAPK14
Application Verdünnung: WB: WB,1:500 - 1:1000