Ephrin B2 Rabbit mAb, Clone: [ARC0576], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11349S
Artikelname: Ephrin B2 Rabbit mAb, Clone: [ARC0576], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11349S
Hersteller Artikelnummer: CNA11349S
Alternativnummer: MBL-CNA11349S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ephrin B2 (P52799).
Konjugation: Unconjugated
Alternative Synonym: HTKL, EPLG5, Htk-L, LERK5, ephrin-B2
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0576]
Molekulargewicht: 37kDa
NCBI: 1948
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLN
Target-Kategorie: EFNB2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200