mTOR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11354P
Artikelname: mTOR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11354P
Hersteller Artikelnummer: CNA11354P
Alternativnummer: MBL-CNA11354P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2388-2487 of human mTOR (NP_004949.1).
Konjugation: Unconjugated
Alternative Synonym: SKS, FRAP, FRAP1, FRAP2, RAFT1, RAPT1
Klonalität: Polyclonal
Molekulargewicht: 289kDa
NCBI: 2475
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: EVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGL
Target-Kategorie: MTOR
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200